MFAP1 polyclonal antibody
  • MFAP1 polyclonal antibody

MFAP1 polyclonal antibody

Ref: AB-PAB23931
MFAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFAP1.
Información adicional
Size 100 uL
Gene Name MFAP1
Gene Alias -
Gene Description microfibrillar-associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4236
Iso type IgG

Enviar un mensaje


MFAP1 polyclonal antibody

MFAP1 polyclonal antibody