ZNF646 polyclonal antibody
  • ZNF646 polyclonal antibody

ZNF646 polyclonal antibody

Ref: AB-PAB23929
ZNF646 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF646.
Información adicional
Size 100 uL
Gene Name ZNF646
Gene Alias KIAA0296
Gene Description zinc finger protein 646
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RELEDNEGLESPQDPSGESPHGAEGNLESDGDCLQAESEGDKCGLERDETHFQGDKESGGTGEGLERKDASLLDNLDIPGEEGGGTHFCDSLTGVDEDQKPATGQPNSSSHSANAVTGWQAGAAHTCSDCGHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF646.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9726
Iso type IgG

Enviar un mensaje


ZNF646 polyclonal antibody

ZNF646 polyclonal antibody