KCNE1L polyclonal antibody
  • KCNE1L polyclonal antibody

KCNE1L polyclonal antibody

Ref: AB-PAB23924
KCNE1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNE1L.
Información adicional
Size 100 uL
Gene Name KCNE1L
Gene Alias KCNE5
Gene Description KCNE1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNE1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23630
Iso type IgG

Enviar un mensaje


KCNE1L polyclonal antibody

KCNE1L polyclonal antibody