CALY polyclonal antibody
  • CALY polyclonal antibody

CALY polyclonal antibody

Ref: AB-PAB23919
CALY polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CALY.
Información adicional
Size 100 uL
Gene Name CALY
Gene Alias DRD1IP|NSG3
Gene Description calcyon neuron-specific vesicular protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CALY.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50632
Iso type IgG

Enviar un mensaje


CALY polyclonal antibody

CALY polyclonal antibody