MGA polyclonal antibody
  • MGA polyclonal antibody

MGA polyclonal antibody

Ref: AB-PAB23917
MGA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MGA.
Información adicional
Size 100 uL
Gene Name MGA
Gene Alias FLJ12634|KIAA0518|MAD5|MXD5
Gene Description MAX gene associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKTECDSWSRIS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MGA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23269
Iso type IgG

Enviar un mensaje


MGA polyclonal antibody

MGA polyclonal antibody