SFT2D2 polyclonal antibody
  • SFT2D2 polyclonal antibody

SFT2D2 polyclonal antibody

Ref: AB-PAB23913
SFT2D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SFT2D2.
Información adicional
Size 100 uL
Gene Name SFT2D2
Gene Alias FLJ34085|UNQ512|dJ747L4.C1.2
Gene Description SFT2 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SFT2D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375035
Iso type IgG

Enviar un mensaje


SFT2D2 polyclonal antibody

SFT2D2 polyclonal antibody