C9orf40 polyclonal antibody
  • C9orf40 polyclonal antibody

C9orf40 polyclonal antibody

Ref: AB-PAB23910
C9orf40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf40.
Información adicional
Size 100 uL
Gene Name C9orf40
Gene Alias FLJ10110|FLJ25795
Gene Description chromosome 9 open reading frame 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VASRQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDME
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55071
Iso type IgG

Enviar un mensaje


C9orf40 polyclonal antibody

C9orf40 polyclonal antibody