DDA1 polyclonal antibody
  • DDA1 polyclonal antibody

DDA1 polyclonal antibody

Ref: AB-PAB23906
DDA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDA1.
Información adicional
Size 100 uL
Gene Name DDA1
Gene Alias C19orf58|MGC2594|PCIA1
Gene Description DET1 and DDB1 associated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79016
Iso type IgG

Enviar un mensaje


DDA1 polyclonal antibody

DDA1 polyclonal antibody