ARRDC4 polyclonal antibody
  • ARRDC4 polyclonal antibody

ARRDC4 polyclonal antibody

Ref: AB-PAB23904
ARRDC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARRDC4.
Información adicional
Size 100 uL
Gene Name ARRDC4
Gene Alias FLJ36045
Gene Description arrestin domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARRDC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91947
Iso type IgG

Enviar un mensaje


ARRDC4 polyclonal antibody

ARRDC4 polyclonal antibody