FAM118B polyclonal antibody
  • FAM118B polyclonal antibody

FAM118B polyclonal antibody

Ref: AB-PAB23902
FAM118B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM118B.
Información adicional
Size 100 uL
Gene Name FAM118B
Gene Alias FLJ21103
Gene Description family with sequence similarity 118, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KHKSDLEHFMLVRRGDVDEFKKLRENMLDKGIKVISYGDDYADLPEYFKRLTCEISTRGTSAGMVREGQLNGSSAAHSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM118B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79607
Iso type IgG

Enviar un mensaje


FAM118B polyclonal antibody

FAM118B polyclonal antibody