RINL polyclonal antibody
  • RINL polyclonal antibody

RINL polyclonal antibody

Ref: AB-PAB23899
RINL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RINL.
Información adicional
Size 100 uL
Gene Name RINL
Gene Alias FLJ44131|FLJ45909
Gene Description Ras and Rab interactor-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RDVLPRTLLLPPPTLGPRDEHTDPVQIGRVQQDTPGKVLSIVNQLYLETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RINL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126432
Iso type IgG

Enviar un mensaje


RINL polyclonal antibody

RINL polyclonal antibody