ZNF749 polyclonal antibody
  • ZNF749 polyclonal antibody

ZNF749 polyclonal antibody

Ref: AB-PAB23898
ZNF749 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF749.
Información adicional
Size 100 uL
Gene Name ZNF749
Gene Alias FLJ16263|FLJ16360
Gene Description zinc finger protein 749
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSEGFLSKRSDPIEHQEILSRPTPYECTQC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF749.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388567
Iso type IgG

Enviar un mensaje


ZNF749 polyclonal antibody

ZNF749 polyclonal antibody