DCTN5 polyclonal antibody
  • DCTN5 polyclonal antibody

DCTN5 polyclonal antibody

Ref: AB-PAB23889
DCTN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DCTN5.
Información adicional
Size 100 uL
Gene Name DCTN5
Gene Alias MGC3248|p25
Gene Description dynactin 5 (p25)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DCTN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84516
Iso type IgG

Enviar un mensaje


DCTN5 polyclonal antibody

DCTN5 polyclonal antibody