SPACA4 polyclonal antibody
  • SPACA4 polyclonal antibody

SPACA4 polyclonal antibody

Ref: AB-PAB23879
SPACA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPACA4.
Información adicional
Size 100 uL
Gene Name SPACA4
Gene Alias SAMP14
Gene Description sperm acrosome associated 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPACA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 171169
Iso type IgG

Enviar un mensaje


SPACA4 polyclonal antibody

SPACA4 polyclonal antibody