SHKBP1 polyclonal antibody
  • SHKBP1 polyclonal antibody

SHKBP1 polyclonal antibody

Ref: AB-PAB23870
SHKBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHKBP1.
Información adicional
Size 100 uL
Gene Name SHKBP1
Gene Alias PP203|Sb1
Gene Description SH3KBP1 binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVFPVKRRNRHSLVGPQQLGGRPAPVRRSNTMPPNLGNAGLLGRMLDEKTPPSPSGQPEEPGMVRLVCGHHNWIAVAYTQFLVCYRLKEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHKBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92799
Iso type IgG

Enviar un mensaje


SHKBP1 polyclonal antibody

SHKBP1 polyclonal antibody