FAM212A polyclonal antibody
  • FAM212A polyclonal antibody

FAM212A polyclonal antibody

Ref: AB-PAB23867
FAM212A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM212A.
Información adicional
Size 100 uL
Gene Name FAM212A
Gene Alias C3orf54|INKA1
Gene Description family with sequence similarity 212, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WDSGFSEVSGSTWREEELPVSQRPAPSAQPLRRQCLSVSGLPMPSRAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM212A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389119
Iso type IgG

Enviar un mensaje


FAM212A polyclonal antibody

FAM212A polyclonal antibody