CCDC125 polyclonal antibody
  • CCDC125 polyclonal antibody

CCDC125 polyclonal antibody

Ref: AB-PAB23866
CCDC125 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC125.
Información adicional
Size 100 uL
Gene Name CCDC125
Gene Alias KENAE
Gene Description coiled-coil domain containing 125
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLNQRYLEALAMLDIKQQKMAQENMCCDKSGFAEASGLELAVLGACLCHGPGGNPCSCARMAASTRKLLLQLKQELEILQKSKEEAYVMADAFRIAFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC125.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 202243
Iso type IgG

Enviar un mensaje


CCDC125 polyclonal antibody

CCDC125 polyclonal antibody