PPP4R4 polyclonal antibody
  • PPP4R4 polyclonal antibody

PPP4R4 polyclonal antibody

Ref: AB-PAB23865
PPP4R4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP4R4.
Información adicional
Size 100 uL
Gene Name PPP4R4
Gene Alias KIAA1622|PP4R4
Gene Description protein phosphatase 4, regulatory subunit 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP4R4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57718
Iso type IgG

Enviar un mensaje


PPP4R4 polyclonal antibody

PPP4R4 polyclonal antibody