PPP1R14D polyclonal antibody
  • PPP1R14D polyclonal antibody

PPP1R14D polyclonal antibody

Ref: AB-PAB23862
PPP1R14D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R14D.
Información adicional
Size 100 uL
Gene Name PPP1R14D
Gene Alias CPI17-like|FLJ20251|GBPI-1|MGC119014|MGC119016
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 14D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R14D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54866
Iso type IgG

Enviar un mensaje


PPP1R14D polyclonal antibody

PPP1R14D polyclonal antibody