EXOSC9 polyclonal antibody
  • EXOSC9 polyclonal antibody

EXOSC9 polyclonal antibody

Ref: AB-PAB23860
EXOSC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXOSC9.
Información adicional
Size 100 uL
Gene Name EXOSC9
Gene Alias PM/Scl-75|PMSCL1|RRP45|Rrp45p|p5|p6
Gene Description exosome component 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXOSC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5393
Iso type IgG

Enviar un mensaje


EXOSC9 polyclonal antibody

EXOSC9 polyclonal antibody