CEP44 polyclonal antibody
  • CEP44 polyclonal antibody

CEP44 polyclonal antibody

Ref: AB-PAB23859
CEP44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP44.
Información adicional
Size 100 uL
Gene Name CEP44
Gene Alias KIAA1712|PS1TP3
Gene Description centrosomal protein 44kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80817
Iso type IgG

Enviar un mensaje


CEP44 polyclonal antibody

CEP44 polyclonal antibody