C15orf52 polyclonal antibody
  • C15orf52 polyclonal antibody

C15orf52 polyclonal antibody

Ref: AB-PAB23858
C15orf52 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf52.
Información adicional
Size 100 uL
Gene Name C15orf52
Gene Alias DKFZp686N1468|FLJ43339
Gene Description chromosome 15 open reading frame 52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf52.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388115
Iso type IgG

Enviar un mensaje


C15orf52 polyclonal antibody

C15orf52 polyclonal antibody