IST1 polyclonal antibody
  • IST1 polyclonal antibody

IST1 polyclonal antibody

Ref: AB-PAB23856
IST1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IST1.
Información adicional
Size 100 uL
Gene Name IST1
Gene Alias OLC1
Gene Description increased sodium tolerance 1 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq APRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IST1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9798
Iso type IgG

Enviar un mensaje


IST1 polyclonal antibody

IST1 polyclonal antibody