FUZ polyclonal antibody
  • FUZ polyclonal antibody

FUZ polyclonal antibody

Ref: AB-PAB23853
FUZ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FUZ.
Información adicional
Size 100 uL
Gene Name FUZ
Gene Alias FLJ22688|FY
Gene Description fuzzy homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FUZ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80199
Iso type IgG

Enviar un mensaje


FUZ polyclonal antibody

FUZ polyclonal antibody