C15orf57 polyclonal antibody
  • C15orf57 polyclonal antibody

C15orf57 polyclonal antibody

Ref: AB-PAB23840
C15orf57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf57.
Información adicional
Size 100 uL
Gene Name C15orf57
Gene Alias CCDC32|FLJ25915|MGC20481
Gene Description chromosome 15 open reading frame 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSGLRFQMKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90416
Iso type IgG

Enviar un mensaje


C15orf57 polyclonal antibody

C15orf57 polyclonal antibody