ANO3 polyclonal antibody
  • ANO3 polyclonal antibody

ANO3 polyclonal antibody

Ref: AB-PAB23833
ANO3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANO3.
Información adicional
Size 100 uL
Gene Name ANO3
Gene Alias C11orf25|GENX-3947|TMEM16C
Gene Description anoctamin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANO3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63982
Iso type IgG

Enviar un mensaje


ANO3 polyclonal antibody

ANO3 polyclonal antibody