TSPAN16 polyclonal antibody
  • TSPAN16 polyclonal antibody

TSPAN16 polyclonal antibody

Ref: AB-PAB23831
TSPAN16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSPAN16.
Información adicional
Size 100 uL
Gene Name TSPAN16
Gene Alias TM-8|TM4-B|TM4SF16
Gene Description tetraspanin 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSPAN16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26526
Iso type IgG

Enviar un mensaje


TSPAN16 polyclonal antibody

TSPAN16 polyclonal antibody