ZNF720 polyclonal antibody
  • ZNF720 polyclonal antibody

ZNF720 polyclonal antibody

Ref: AB-PAB23828
ZNF720 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF720.
Información adicional
Size 100 uL
Gene Name ZNF720
Gene Alias MGC62019|MGC9313
Gene Description zinc finger protein 720
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEGKCEGHNGYYDGHTKCKTTTYNKNLTVTGGQKHEKTQFMSVAFSKPCVSVSKCQHQFLKLTFSFKGNLDNPNSDLVHVSNNHLNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF720.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124411
Iso type IgG

Enviar un mensaje


ZNF720 polyclonal antibody

ZNF720 polyclonal antibody