C16orf72 polyclonal antibody
  • C16orf72 polyclonal antibody

C16orf72 polyclonal antibody

Ref: AB-PAB23827
C16orf72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf72.
Información adicional
Size 100 uL
Gene Name C16orf72
Gene Alias FLJ41272|PRO0149
Gene Description chromosome 16 open reading frame 72
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf72.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29035
Iso type IgG

Enviar un mensaje


C16orf72 polyclonal antibody

C16orf72 polyclonal antibody