DEXI polyclonal antibody
  • DEXI polyclonal antibody

DEXI polyclonal antibody

Ref: AB-PAB23818
DEXI polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEXI.
Información adicional
Size 100 uL
Gene Name DEXI
Gene Alias MYLE
Gene Description dexamethasone-induced transcript
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEXI.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28955
Iso type IgG

Enviar un mensaje


DEXI polyclonal antibody

DEXI polyclonal antibody