TMEM205 polyclonal antibody
  • TMEM205 polyclonal antibody

TMEM205 polyclonal antibody

Ref: AB-PAB23817
TMEM205 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM205.
Información adicional
Size 100 uL
Gene Name TMEM205
Gene Alias MGC110858|UNQ501
Gene Description transmembrane protein 205
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYH
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM205.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374882
Iso type IgG

Enviar un mensaje


TMEM205 polyclonal antibody

TMEM205 polyclonal antibody