ANKS3 polyclonal antibody
  • ANKS3 polyclonal antibody

ANKS3 polyclonal antibody

Ref: AB-PAB23813
ANKS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKS3.
Información adicional
Size 100 uL
Gene Name ANKS3
Gene Alias FLJ32345|FLJ32767|KIAA1977
Gene Description ankyrin repeat and sterile alpha motif domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKS3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124401
Iso type IgG

Enviar un mensaje


ANKS3 polyclonal antibody

ANKS3 polyclonal antibody