SETD6 polyclonal antibody
  • SETD6 polyclonal antibody

SETD6 polyclonal antibody

Ref: AB-PAB23812
SETD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SETD6.
Información adicional
Size 100 uL
Gene Name SETD6
Gene Alias FLJ21148
Gene Description SET domain containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SETD6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79918
Iso type IgG

Enviar un mensaje


SETD6 polyclonal antibody

SETD6 polyclonal antibody