TELO2 polyclonal antibody
  • TELO2 polyclonal antibody

TELO2 polyclonal antibody

Ref: AB-PAB23808
TELO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TELO2.
Información adicional
Size 100 uL
Gene Name TELO2
Gene Alias CLK2|DKFZp434A073|FLJ10924|KIAA0683|TEL2|c305C8.3|hCLK2
Gene Description TEL2, telomere maintenance 2, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SKAVLICLAQLGEPELRDSRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVVSARIHPEGPPLKFQYEEDELSLELLALASPQPAGDGASEAGTSLVPATA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TELO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9894
Iso type IgG

Enviar un mensaje


TELO2 polyclonal antibody

TELO2 polyclonal antibody