GDPD3 polyclonal antibody
  • GDPD3 polyclonal antibody

GDPD3 polyclonal antibody

Ref: AB-PAB23807
GDPD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GDPD3.
Información adicional
Size 100 uL
Gene Name GDPD3
Gene Alias FLJ22603|MGC4171
Gene Description glycerophosphodiester phosphodiesterase domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GDPD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79153
Iso type IgG

Enviar un mensaje


GDPD3 polyclonal antibody

GDPD3 polyclonal antibody