C14orf159 polyclonal antibody
  • C14orf159 polyclonal antibody

C14orf159 polyclonal antibody

Ref: AB-PAB23804
C14orf159 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf159.
Información adicional
Size 100 uL
Gene Name C14orf159
Gene Alias C14orf160|DKFZp686I02128|FLJ20950|FLJ39943|FLJ39975
Gene Description chromosome 14 open reading frame 159
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf159.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80017
Iso type IgG

Enviar un mensaje


C14orf159 polyclonal antibody

C14orf159 polyclonal antibody