FLYWCH2 polyclonal antibody
  • FLYWCH2 polyclonal antibody

FLYWCH2 polyclonal antibody

Ref: AB-PAB23790
FLYWCH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLYWCH2.
Información adicional
Size 100 uL
Gene Name FLYWCH2
Gene Alias -
Gene Description FLYWCH family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLYWCH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114984
Iso type IgG

Enviar un mensaje


FLYWCH2 polyclonal antibody

FLYWCH2 polyclonal antibody