C10orf47 polyclonal antibody
  • C10orf47 polyclonal antibody

C10orf47 polyclonal antibody

Ref: AB-PAB23783
C10orf47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf47.
Información adicional
Size 100 uL
Gene Name C10orf47
Gene Alias MGC35403
Gene Description chromosome 10 open reading frame 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLLRSVPTPLVMAQKISERMAGNEALSPTSPFREGRPGEWRTPAARGPRSGDPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254427
Iso type IgG

Enviar un mensaje


C10orf47 polyclonal antibody

C10orf47 polyclonal antibody