MTHFSD polyclonal antibody
  • MTHFSD polyclonal antibody

MTHFSD polyclonal antibody

Ref: AB-PAB23782
MTHFSD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTHFSD.
Información adicional
Size 100 uL
Gene Name MTHFSD
Gene Alias FLJ12998|FLJ13893|MGC138262|MGC138264
Gene Description methenyltetrahydrofolate synthetase domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTHFSD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64779
Iso type IgG

Enviar un mensaje


MTHFSD polyclonal antibody

MTHFSD polyclonal antibody