TMCO7 polyclonal antibody
  • TMCO7 polyclonal antibody

TMCO7 polyclonal antibody

Ref: AB-PAB23779
TMCO7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMCO7.
Información adicional
Size 100 uL
Gene Name TMCO7
Gene Alias FLJ12688|KIAA1746
Gene Description transmembrane and coiled-coil domains 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKELTHVASENETELKTEPFSSKSLLELEQHQTLLVEGQERKLLVLQLMAVLCERMSEQIFTNVTQVVDFVAATLQRACASLAHQAESTVESQTLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMCO7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79613
Iso type IgG

Enviar un mensaje


TMCO7 polyclonal antibody

TMCO7 polyclonal antibody