CORO2A polyclonal antibody
  • CORO2A polyclonal antibody

CORO2A polyclonal antibody

Ref: AB-PAB23778
CORO2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CORO2A.
Información adicional
Size 100 uL
Gene Name CORO2A
Gene Alias CLIPINB|DKFZp686G19226|IR10|WDR2
Gene Description coronin, actin binding protein, 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CORO2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7464
Iso type IgG

Enviar un mensaje


CORO2A polyclonal antibody

CORO2A polyclonal antibody