KBTBD8 polyclonal antibody
  • KBTBD8 polyclonal antibody

KBTBD8 polyclonal antibody

Ref: AB-PAB23776
KBTBD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KBTBD8.
Información adicional
Size 100 uL
Gene Name KBTBD8
Gene Alias KIAA1842|TA-KRP
Gene Description kelch repeat and BTB (POZ) domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KBTBD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84541
Iso type IgG

Enviar un mensaje


KBTBD8 polyclonal antibody

KBTBD8 polyclonal antibody