C12orf26 polyclonal antibody
  • C12orf26 polyclonal antibody

C12orf26 polyclonal antibody

Ref: AB-PAB23767
C12orf26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf26.
Información adicional
Size 100 uL
Gene Name C12orf26
Gene Alias FLJ22789
Gene Description chromosome 12 open reading frame 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84190
Iso type IgG

Enviar un mensaje


C12orf26 polyclonal antibody

C12orf26 polyclonal antibody