C16orf45 polyclonal antibody
  • C16orf45 polyclonal antibody

C16orf45 polyclonal antibody

Ref: AB-PAB23750
C16orf45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf45.
Información adicional
Size 100 uL
Gene Name C16orf45
Gene Alias FLJ32618
Gene Description chromosome 16 open reading frame 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRRESELRFMMDDIQLCKDIMDLKQEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89927
Iso type IgG

Enviar un mensaje


C16orf45 polyclonal antibody

C16orf45 polyclonal antibody