WDR59 polyclonal antibody
  • WDR59 polyclonal antibody

WDR59 polyclonal antibody

Ref: AB-PAB23747
WDR59 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR59.
Información adicional
Size 100 uL
Gene Name WDR59
Gene Alias FLJ12270|FP977|MGC11230
Gene Description WD repeat domain 59
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR59.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79726
Iso type IgG

Enviar un mensaje


WDR59 polyclonal antibody

WDR59 polyclonal antibody