C2orf44 polyclonal antibody
  • C2orf44 polyclonal antibody

C2orf44 polyclonal antibody

Ref: AB-PAB23743
C2orf44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf44.
Información adicional
Size 100 uL
Gene Name C2orf44
Gene Alias FLJ21945|PP384
Gene Description chromosome 2 open reading frame 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QQIRLENTERPKGICFLTDQLLLILVGKQKLTDTTFLPSSKSDQYAISLIVREIMLEEEPSITSGESQTTYSTFSAPLNK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80304
Iso type IgG

Enviar un mensaje


C2orf44 polyclonal antibody

C2orf44 polyclonal antibody