FAM92B polyclonal antibody
  • FAM92B polyclonal antibody

FAM92B polyclonal antibody

Ref: AB-PAB23737
FAM92B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM92B.
Información adicional
Size 100 uL
Gene Name FAM92B
Gene Alias FLJ44299|MGC138149
Gene Description family with sequence similarity 92, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM92B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339145
Iso type IgG

Enviar un mensaje


FAM92B polyclonal antibody

FAM92B polyclonal antibody