FSIP1 polyclonal antibody
  • FSIP1 polyclonal antibody

FSIP1 polyclonal antibody

Ref: AB-PAB23733
FSIP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FSIP1.
Información adicional
Size 100 uL
Gene Name FSIP1
Gene Alias FLJ35989|HSD10
Gene Description fibrous sheath interacting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQKPDRDGERNMEVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FSIP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 161835
Iso type IgG

Enviar un mensaje


FSIP1 polyclonal antibody

FSIP1 polyclonal antibody