KIAA1328 polyclonal antibody
  • KIAA1328 polyclonal antibody

KIAA1328 polyclonal antibody

Ref: AB-PAB23723
KIAA1328 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1328.
Información adicional
Size 100 uL
Gene Name KIAA1328
Gene Alias -
Gene Description KIAA1328
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QEELHMKECPHLKPTPSQCCGHRLAADRVHDSHPTNMTPQHPKTHPESCSYCRLSWASLVHGGGALQPIETLKKQISEDRKQQLMLQKMELE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1328.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57536
Iso type IgG

Enviar un mensaje


KIAA1328 polyclonal antibody

KIAA1328 polyclonal antibody