C18orf32 polyclonal antibody
  • C18orf32 polyclonal antibody

C18orf32 polyclonal antibody

Ref: AB-PAB23717
C18orf32 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C18orf32.
Información adicional
Size 100 uL
Gene Name C18orf32
Gene Alias FLJ23458
Gene Description chromosome 18 open reading frame 32
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C18orf32.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 497661
Iso type IgG

Enviar un mensaje


C18orf32 polyclonal antibody

C18orf32 polyclonal antibody